PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009598866.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 283aa    MW: 32566.1 Da    PI: 7.9585
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009598866.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.18.2e-54101351128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL+++++++++++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nra+ sgyWkatg+dk+++s 
  XP_009598866.1  10 LPPGFRFHPTDEELIMYYLRNQATSRPCPV-SIIPEVDVYKFDPWELPEKAEFGEREWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS- 102
                     79****************************.89***************99999*****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++ vg+kk Lvfy+gr pkg ktdW+mheyrl
  XP_009598866.1 103 GSKYVGIKKALVFYEGRPPKGIKTDWIMHEYRL 135
                     999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-668162IPR003441NAC domain
PROSITE profilePS5100561.63710162IPR003441NAC domain
PfamPF023651.9E-2611135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MVGKNCSEEL PPGFRFHPTD EELIMYYLRN QATSRPCPVS IIPEVDVYKF DPWELPEKAE  60
FGEREWYFFT PRDRKYPNGV RPNRAAVSGY WKATGTDKAI YSGSKYVGIK KALVFYEGRP  120
PKGIKTDWIM HEYRLSESRS QPIRLNGSMR LDDWVLCRIY KKKNLGRAME MMKVEEDTKQ  180
PEILSTNPVE IVAATGPQTL KLPRACSLSH LLEMDYFGSI SQLFDDNSYN ANNQNTMTNV  240
NVGNVPHHAM EKFQLGELSH QYMTSTNVNG NVPIFVNPAF QFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-721016417167NO APICAL MERISTEM PROTEIN
1ut4_B1e-721016417167NO APICAL MERISTEM PROTEIN
1ut7_A1e-721016417167NO APICAL MERISTEM PROTEIN
1ut7_B1e-721016417167NO APICAL MERISTEM PROTEIN
4dul_A1e-721016417167NAC domain-containing protein 19
4dul_B1e-721016417167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598866.10.0PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-111NAC29_ARATH; NAC transcription factor 29
TrEMBLM0ZSU11e-169M0ZSU1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000073411e-168(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-112NAC-like, activated by AP3/PI